Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98133, FcZero-rAb™ APC Anti-Human CD244 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98133
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100tests The CD244 (APC-FcA98133) by Proteintech is a Recombinant antibody targeting CD244 in FC applications with reactivity to human samples APC-FcA98133 targets CD244 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human PBMCs Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension Background Information CD244, also known as SLAMF4 or 2B4, is a type I transmembrane glycoprotein belonging to the signaling lymphocyte activation molecule (SLAM) family. It consists of an extracellular segment with two immunoglobulin (Ig)-like domains, a transmembrane region, and a cytoplasmic domain containing tyrosine-based motifs (PMID: 9841922; 30546369). CD244 is present on natural killer (NK) cells, γδ T cells, a subset of CD8+ T cells, monocytes, basophils, dendritic cells, and myeloid-derived suppressor cells (MDSCs) (PMID: 30546369). It binds to CD48 with high affinity and transmits stimulatory or inhibitory signals that regulate immune function (PMID: 9841922; 18523281). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg32087 Product name: Recombinant Human CD244 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 22-221 aa of BC053985 Sequence: CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR Predict reactive species Full Name: CD244 molecule, natural killer cell receptor 2B4 Calculated Molecular Weight: 365 aa, 41 kDa GenBank Accession Number: BC053985 Gene Symbol: CD244 Gene ID (NCBI): 51744 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BZW8 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924