Product Description
Size: 100tests
The IL-1 beta (APC-FcA98142) by Proteintech is a Recombinant antibody targeting IL-1 beta in FC (Intra) applications with reactivity to human samples
APC-FcA98142 targets IL-1 beta in FC (Intra) applications and shows reactivity with human samples.
Tested Applications
Positive FC (Intra) detected in: IFN gamma, LPS and Brefeldin A treated human PBMCs
Recommended dilution
Flow Cytometry (FC) (INTRA): FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension
Background Information
Interleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg0286 Product name: Recombinant Human IL-1 Beta protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*HIS Domain: 117-269 aa of BC008678 Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Predict reactive species
Full Name: interleukin 1, beta
Calculated Molecular Weight: 269 aa, 31 kDa
GenBank Accession Number: BC008678
Gene Symbol: IL1B
Gene ID (NCBI): 3553
ENSEMBL Gene ID: ENSG00000125538
Conjugate: APC Fluorescent Dye
Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P01584
Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924