Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98154, FcZero-rAb™ APC Anti-Human TREM-1/CD354 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98154
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100tests The TREM-1/CD354 (APC-FcA98154) by Proteintech is a Recombinant antibody targeting TREM-1/CD354 in FC applications with reactivity to human samples APC-FcA98154 targets TREM-1/CD354 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood leukocytes Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in 100 μl suspension Background Information Triggering receptor expressed on myeloid cells 1 (TREM-1, also known as CD354) is a member of the immunoglobulin superfamily, which is expressed on neutrophils and monocytes. TREM1 plays a role in the innate immune system. TREM1 amplifies neutrophil and monocyte-mediated inflammatory responses triggered by bacterial and fungal infections by stimulating release of pro-inflammatory chemokines and cytokines, as well as increased surface expression of cell activation markers. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1438 Product name: Recombinant Human TREM-1/CD354 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 21-200 aa of NM_018643.5 Sequence: ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIR Predict reactive species Full Name: triggering receptor expressed on myeloid cells 1 Calculated Molecular Weight: 26kDa GenBank Accession Number: NM_018643.5 Gene Symbol: TREM1 Gene ID (NCBI): 54210 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NP99-1 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924