Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98169, FcZero-rAb™ APC Anti-Human CEACAM3/6 (CD66c/d) Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98169
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100tests The CEACAM3/6 (CD66c/d) (APC-FcA98169) by Proteintech is a Recombinant antibody targeting CEACAM3/6 (CD66c/d) in FC applications with reactivity to human samples APC-FcA98169 targets CEACAM3/6 (CD66c/d) in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood leukocytes Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension Background Information Carcinoembryonic antigen-related cell adhesion molecules (CEACAMs) belong to the immunoglobulin superfamily of cell adhesion molecules. CEACAMs play major roles in cell-cell and cell-ECM adhesion and have been implicated in controlling cell proliferation, angiogenesis, and tissue remodeling (PMID: 23021083). CEACAM3, also named as CD66d and CGM1, is exclusively expressed on granulocytes and acts as the major granulocyte receptor mediating recognition and efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms (PMID: 18606569). CEACAM6, also known as CD66c, is normally expressed on the surface of myeloid and epithelial surfaces and upregulated preferentially at the apical/luminal membranes of many tumors (PMID: 27595061; 35082925). This antibody is raised against 35-155 aa of human CEACAM3/CD66d and can cross-react with CEACAM6/CD66c. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0144 Product name: Recombinant Human CEACAM-3 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 35-155 aa of BC106728 Sequence: KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG Predict reactive species Full Name: carcinoembryonic antigen-related cell adhesion molecule 3 Calculated Molecular Weight: 252 aa, 27 kDa GenBank Accession Number: BC106728 Gene Symbol: CEACAM3 Gene ID (NCBI): 1084 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P40198 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924