Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98181, FcZero-rAb™ APC Anti-Human CD134/OX40 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98181
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100tests The CD134/OX40 (APC-FcA98181) by Proteintech is a Recombinant antibody targeting CD134/OX40 in FC applications with reactivity to human samples APC-FcA98181 targets CD134/OX40 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: PHA treated human PBMCs Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in 100 μl suspension Background Information CD134, also known as OX40 and TNFRSF4, is a member of the TNFR-superfamily of receptors (PMID: 2828930; 9766631). It is a type I transmembrane protein predominantly expressed on activated T cells which include CD4 and CD8 T cells, Th2, Th1, and Th17 cells, as well as regulatory T cells (Tregs) (PMID: 20307208). CD134 is activated by its cognate ligand CD134L (OX40L) and functions as a T cell co-stimulatory molecule (PMID: 26215166). CD134-CD134L interactions have been proposed as a potential therapeutic target for treating autoimmune diseases, cancer and infectious disease (PMID: 26215166; 19426222). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1261 Product name: Recombinant Human OX40/TNFRSF4 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 29-214 aa of NM_003327 Sequence: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRA Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 4 Calculated Molecular Weight: 29 kDa GenBank Accession Number: NM_003327 Gene Symbol: CD134 Gene ID (NCBI): 7293 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P43489 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924