Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98211, FcZero-rAb™ APC Anti-Human CXCL9/MIG Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98211
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100tests The CXCL9/MIG (APC-FcA98211) by Proteintech is a Recombinant antibody targeting CXCL9/MIG in FC (Intra) applications with reactivity to human samples APC-FcA98211 targets CXCL9/MIG in FC (Intra) applications and shows reactivity with human samples. Tested Applications Positive FC (Intra) detected in: IFN gamma, TNF alpha and Brefeldin A treated human PBMCs Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension Background Information CXCL9 is a small cytokine known as MIG. CXCL9 is a T-cell chemoattractant, which is induced by IFN-γ. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. A high level of CXCL9 revealed in peripheral liquids, can be considered as a marker of host immune response, especially of that involving Th1 cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17932 Product name: Recombinant human CXCL9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-125 aa of BC095396 Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT Predict reactive species Full Name: chemokine (C-X-C motif) ligand 9 Calculated Molecular Weight: 14 kDa GenBank Accession Number: BC095396 Gene Symbol: CXCL9 Gene ID (NCBI): 4283 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q07325 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924