Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98214, FcZero-rAb™ APC Anti-Human ICOS/CD278 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98214
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100tests The ICOS/CD278 (APC-FcA98214) by Proteintech is a Recombinant antibody targeting ICOS/CD278 in FC applications with reactivity to human samples APC-FcA98214 targets ICOS/CD278 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: PHA treated human PBMCs Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in 100 μl suspension Background Information Inducible T cell co-stimulator (ICOS) is related to the CD28 superfamily and is highly expressed on activated T cells as well as regulatory T cells and is crucial for the survival and function of T cells, Th2 cell differentiation, and lung inflammatory responses. Binding ICOS to ICOS-ligand (ICOS-L) activates a cascade of intracellular signaling molecules that prevent apoptosis and lead to the production of cytokines such as IL-4 and IL-13. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1642 Product name: recombinant human ICOS protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-140 aa of BC028210 Sequence: EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLK Predict reactive species Full Name: inducible T-cell co-stimulator Calculated Molecular Weight: 199 aa, 23 kDa GenBank Accession Number: BC028210 Gene Symbol: ICOS Gene ID (NCBI): 29851 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y6W8 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924