Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98217, FcZero-rAb™ APC Anti-Mouse CD79b Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98217
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CD79b (APC-FcA98217) by Proteintech is a Recombinant antibody targeting CD79b in FC applications with reactivity to mouse samples APC-FcA98217 targets CD79b in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse bone marrow cells Recommended dilution Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension Background Information CD79 molecule encompasses two transmembrane proteins, CD79a and CD79b, which form a disulfide-linked heterodimer and are members of the immunoglobulin (Ig) gene superfamily (PMID: 2033258; 1375264; 2304550). CD79b molecule (also known as B29, IGB, AGM6, and Igbeta) is expressed almost exclusively on B cells and B-cell neoplasms, influencing antigen internalization and increasing antigen presentation efficiency (PMID: 7552998). CD79b mutation could be a key biomarker for DLBCL disease progression (PMID: 36182550). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2113 Product name: Recombinant Mouse CD79B protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-158 aa of NM_008339.3 Sequence: VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD Predict reactive species Full Name: CD79B antigen Calculated Molecular Weight: 26 kDa GenBank Accession Number: NM_008339.3 Gene Symbol: Cd79b Gene ID (NCBI): 15985 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15530 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924