Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98226, FcZero-rAb™ APC Anti-Human C5AR1/CD88 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98226
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100tests The C5AR1/CD88 (APC-FcA98226) by Proteintech is a Recombinant antibody targeting C5AR1/CD88 in FC applications with reactivity to human samples APC-FcA98226 targets C5AR1/CD88 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood leukocytes Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension Background Information C5aR, also named CD88, is a G protein-coupled receptor for the anaphylatoxin C5a, a cleavage product of the complement cascade. The C5a ligand is a proinflammatory component of host defense. C5aR is activated upon binding of the C5a molecule. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release, and superoxide anion production. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2185 Product name: Recombinant Human C5AR1/CD88 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-37 aa of NM_001736.4 Sequence: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPD Predict reactive species Full Name: complement component 5a receptor 1 Calculated Molecular Weight: 39kDa GenBank Accession Number: NM_001736.4 Gene Symbol: C5aR Gene ID (NCBI): 728 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P21730 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924