Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98246-2, FcZero-rAb™ APC Anti-Mouse BTLA/CD272 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98246-2
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The BTLA/CD272 (APC-FcA98246-2) by Proteintech is a Recombinant antibody targeting BTLA/CD272 in FC applications with reactivity to mouse samples APC-FcA98246-2 targets BTLA/CD272 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension Background Information BTLA, also known as CD272, is a member of the CD28 superfamily and is a type I membrane glycoprotein identified as an inhibitory receptor (PMID: 33859648). BTLA is extensively expressed in lymph nodes, thymus, and spleen, with little or no expression in organs such as the heart, kidney, brain, and liver (PMID: 33859648). Among immune cells, BTLA is primarily expressed in B and T cells, with higher expression in B cells compared to T cells in the mouse spleen (PMID: 33859648). BTLA plays a crucial role in regulating stimulatory and inhibitory signals in immune responses. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1843 Product name: Recombinant Mouse BTLA protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 30-176 aa of AAI08964.1 Sequence: EKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEKRPG Predict reactive species Full Name: B and T lymphocyte associated Calculated Molecular Weight: 34kDa GenBank Accession Number: AAI08964.1 Gene Symbol: Btla Gene ID (NCBI): 208154 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Excitation Laser: Red Laser (633 nm) Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q32MV9 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924