Iright
BRAND / VENDOR: Proteintech

Proteintech, APC-FcA98286, FcZero-rAb™ APC Anti-Mouse LAIR1 Rabbit Recombinant Antibody

CATALOG NUMBER: APC-FcA98286
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The LAIR1 (APC-FcA98286) by Proteintech is a Recombinant antibody targeting LAIR1 in FC applications with reactivity to mouse samples APC-FcA98286 targets LAIR1 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse splenocytes Recommended dilution Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension Background Information Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1) is a transmembrane glycoprotein with a single immunoglobulin-like domain and a cytoplasmic tail containing two immune receptor tyrosine-based inhibitory motifs (PMID: 9285412). LAIR1 is expressed on the majority of human PBMCs, including NK, T, B, monocytes, and dendritic cells, as well as the majority of thymocytes (PMID: 10229813). It functions as an inhibitory receptor that plays a constitutive negative regulatory role on cytolytic function of NK cells, B cells and T cells. LAIR1 is a collagen receptor (PMID: 16754721). Tumor-expressed collagens can modulate immune cell function through the inhibitory collagen receptor LAIR1 (PMID: 21955987). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1879 Product name: Recombinant Mouse LAIR1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 22-141 aa of NM_001113474.1 Sequence: QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTY Predict reactive species Full Name: leukocyte-associated Ig-like receptor 1 Calculated Molecular Weight: 30kDa GenBank Accession Number: NM_001113474.1 Gene Symbol: Lair1 Gene ID (NCBI): 52855 Conjugate: APC Fluorescent Dye Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8BG84-1 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924