Iright
BRAND / VENDOR: Proteintech

Proteintech, Biotin-FcA98232, FcZero-rAb™ Biotin Anti-Mouse IL-3RB/CD131 Rabbit Recombinant Antibody

CATALOG NUMBER: Biotin-FcA98232
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The IL-3RB/CD131 (Biotin-FcA98232) by Proteintech is a Recombinant antibody targeting IL-3RB/CD131 in FC, ELISA applications with reactivity to mouse samples Biotin-FcA98232 targets IL-3RB/CD131 in FC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: mouse bone marrow cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD131, also known as IL-3RB, IL-5RB, colony stimulating factor 2 receptor subunit beta (CSF2RB), or cytokine receptor common subunit beta, is the common subunit of the type I cytokine receptors for granulocyte-macrophage colony-stimulating factor (GM-CSF), IL-3 and IL-5 (PMID: 36532080). It is expressed predominantly by hematopoietic cells but also by non-hematopoietic cells (PMID: 10582335). CD131 mediates intracellular signaling by JAK2, leading to phosphorylation of CD131 and triggering signaling pathways such as STAT5, MAPK and PI3-Kinase/AKT which regulate cell survival, proliferation and function (PMID: 23535386). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2173 Product name: Recombinant Mouse IL-3RB/CD131 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-441 aa of NM_007780.4 Sequence: HGVTEAEETVPLKTLQCYNDYTNHIICSWADTEDAQGLINMTLYHQLEKKQPVSCELSEELMWSECPSSHRCVPRRCVIPYTRFSITNEDYYSFRPDSDLGIQLMVPLAQNVQPPLPKNVSISSSEDRFLLEWSVSLGDAQVSWLSSKDIEFEVAYKRLQDSWEDAYSLHTSKFQVNFEPKLFLPNSIYAARVRTRLSPGSSLSGRPSRWSPEVHWDSQPGDKAQPQNLQCFFDGIQSLHCSWEVWTQTTGSVSFGLFYRPSPVAPEEKCSPVVKEPPGASVYTRYHCSLPVPEPSAHSQYTVSVKHLEQGKFIMSYNHIQMEPPTLNLTKNRDSYSLHWETQKMAYSFIEHTFQVQYKKKSDSWEDSKTENLDRAHSMDLSQLEPDTSYCARVRVKPISNYDGIWSKWSEEYTWKTDW Predict reactive species Full Name: colony stimulating factor 2 receptor, beta, low-affinity (granulocyte-macrophage) Calculated Molecular Weight: 99kDa GenBank Accession Number: NM_007780.4 Gene Symbol: IL-3RB/CD131 Gene ID (NCBI): 12983 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26955 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924