Iright
BRAND / VENDOR: Proteintech

Proteintech, Biotin-FcA98248, FcZero-rAb™ Biotin Anti-Mouse EPCR/CD201 Rabbit Recombinant Antibody

CATALOG NUMBER: Biotin-FcA98248
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The EPCR/CD201 (Biotin-FcA98248) by Proteintech is a Recombinant antibody targeting EPCR/CD201 in FC applications with reactivity to mouse samples Biotin-FcA98248 targets EPCR/CD201 in FC applications and shows reactivity with mouse samples. Tested Applications Positive FC detected in: bEnd.3 cells Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information EPCR, also known as CD201, protein C receptor (PROCR), or activated protein C receptor (APC receptor), is a transmembrane glycoprotein. EPCR promotes the activation of protein C, which has anticoagulant and cytoprotective effects. EPCR facilitates the activation of protein C by the thrombin-thrombomodulin complex but also facilitates APC-mediated cytoprotective effects on cells that involve the activation of protease-activated receptors (PAR) 1 and 3(PMID: 27207424). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1517 Product name: Recombinant Mouse EPCR/CD201 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 18-214 aa of NM_011171.2 Sequence: LCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTS Predict reactive species Full Name: protein C receptor, endothelial Calculated Molecular Weight: 27kDa GenBank Accession Number: NM_011171.2 Gene Symbol: PROCR Gene ID (NCBI): 19124 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q64695 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924