Iright
BRAND / VENDOR: Proteintech

Proteintech, Biotin-FcA98291, FcZero-rAb™ Biotin Anti-Human GPR56 Rabbit Recombinant Antibody

CATALOG NUMBER: Biotin-FcA98291
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The GPR56 (Biotin-FcA98291) by Proteintech is a Recombinant antibody targeting GPR56 in FC, ELISA applications with reactivity to human samples Biotin-FcA98291 targets GPR56 in FC, ELISA applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood leukocytes Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information GPR56 (G-protein-coupled receptor 56, also named ADGRG1) is a member of the adhesion G-protein coupled receptor (aGPCR) family and one of the important players in the normal development of the brain. It plays a pivotal role in diverse neurobiological processes, including cortical formation, oligodendrocyte development, and myelination (PMID: 32798453). Moreover, GPR56 has been reported to regulate VEGF secretion and angiogenesis in melanoma (PMID: 37579299). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2478 Product name: Recombinant Human GPR56 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 26-171 aa of NM_001145771.2 Sequence: RGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHN Predict reactive species Full Name: G protein-coupled receptor 56 Calculated Molecular Weight: 78 kDa GenBank Accession Number: NM_001145771.2 Gene Symbol: GPR56 Gene ID (NCBI): 9289 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y653 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924