Iright
BRAND / VENDOR: Proteintech

Proteintech, Biotin-FcA98329-3, FcZero-rAb™ Biotin Anti-Human CEACAM6/CD66c Rabbit Recombinant Antibody

CATALOG NUMBER: Biotin-FcA98329-3
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CEACAM6/CD66c (Biotin-FcA98329-3) by Proteintech is a Recombinant antibody targeting CEACAM6/CD66c in FC, ELISA applications with reactivity to human samples Biotin-FcA98329-3 targets CEACAM6/CD66c in FC, ELISA applications and shows reactivity with human samples. Tested Applications Positive FC detected in: human peripheral blood leukocyte Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CEACAM6, also known as CD66c, is a glycosylphosphatidylinositol (GPI)-linked cell surface protein that belongs to the CEACAM family of the immunoglobulin superfamily (PMID: 23903773). It is normally expressed on the surface of myeloid and epithelial surfaces and upregulated preferentially at the apical/luminal membranes of many tumors (PMID: 27595061; 35082925). CEACAM6 plays an important role in cell adhesion, proliferation, tumorigenesis, metastasis, and immunity (PMID: 31797958). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2450 Product name: recombinant human CEACAM6 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 35-320 aa of BC005008 Sequence: KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG Predict reactive species Full Name: carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen) Calculated Molecular Weight: 37 kDa GenBank Accession Number: BC005008 Gene Symbol: CEACAM6 Gene ID (NCBI): 4680 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Form: Liquid Purification Method: Protein A purification UNIPROT ID: P40199 Storage Buffer: PBS with 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924