Iright
BRAND / VENDOR: Proteintech

Proteintech, Biotin-SF98318, Biotin Anti-Human CD63 Rabbit scFv Antibody

CATALOG NUMBER: Biotin-SF98318
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ug The CD63 (Biotin-SF98318) by Proteintech is a Recombinant antibody targeting CD63 in FC applications with reactivity to human samples Biotin-SF98318 targets CD63 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: Thrombin treated human peripheral blood platelets Recommended dilution Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CD63 is a 30-60 kDa lysosomal membrane protein that belongs to the tetraspanin family. This protein plays many important roles in immuno-physiological functions. It mediates signal transduction events that regulate cell development, activation, growth, and motility. CD63 is expressed on activated platelets, thus it may function as a blood platelet activation marker. CD63 is a lysosomal membrane glycoprotein translocated to the plasma membrane after platelet activation. The CD63 tetraspanin is highly expressed in the early stages of melanoma and decreases in advanced lesions, suggesting it is a possible suppressor of tumor progression. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Specification Tested Reactivity: human Host / Type: Rabbit / IgG Class: Recombinant Type: Single-chain variable fragment antibody (scFv) Immunogen: CatNo: Eg2064 Product name: Recombinant Human CD63 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 103-203 aa of BC002349 Sequence: AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV Predict reactive species Full Name: CD63 molecule Calculated Molecular Weight: 26 kDa GenBank Accession Number: BC002349 Gene Symbol: CD63 Gene ID (NCBI): 967 Conjugate: Biotin Excitation/Emission Maxima Wavelengths: - Source: Anti-Human CD63 scFv from clone 241964E1, consisting of VH-GGGGS linker-VL (N- to C-terminus), with His tag at the C-terminus. Form: Liquid Purification Method: Affinity purification Storage Buffer: PBS with 4% sucrose and 0.09% sodium azide, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924