Iright
BRAND / VENDOR: Proteintech

Proteintech, CL488-60135, CoraLite® Plus 488-conjugated Chromogranin A Monoclonal antibody

CATALOG NUMBER: CL488-60135
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ul The Chromogranin A (CL488-60135) by Proteintech is a Monoclonal antibody targeting Chromogranin A in IF/ICC, FC (Intra) applications with reactivity to human, mouse, rat, pig samples CL488-60135 targets Chromogranin A in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive IF/ICC detected in: PC-12 cells, SH-SY5Y cells, Neuro-2a cells Positive FC (Intra) detected in: SH-SY5Y cells, Neuro-2a cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information Chromogranin A is a member of the granin family of neuroendocrine secretory proteins. It is located in secretory vesicles of neurons and endocrine cells. Chromogranin A is the precursor to several functional peptides including vasostatin, pancreastatin, catestatin and parastatin. These peptides negatively modulate the neuroendocrine function of the releasing cell (autocrine) or nearby cells (paracrine). CgA is one of the most used tumor markers in NET's (neuroendocrine tumors) , and elevated CgA concentrations have been demonstrated in serum or plasma of patients with different types of these tumors. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0807 Product name: Recombinant human CHGA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-457 aa of BC006459 Sequence: MQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG Predict reactive species Full Name: chromogranin A (parathyroid secretory protein 1) Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC006459 Gene Symbol: Chromogranin A Gene ID (NCBI): 1113 RRID: AB_2934426 Conjugate: CoraLite® Plus 488 Fluorescent Dye Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm Form: Liquid Purification Method: Protein G purification UNIPROT ID: P10645 Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924