Iright
BRAND / VENDOR: Proteintech

Proteintech, CL488-66039, CoraLite® Plus 488-conjugated CPT1A Monoclonal antibody

CATALOG NUMBER: CL488-66039
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ul The CPT1A (CL488-66039) by Proteintech is a Monoclonal antibody targeting CPT1A in FC (Intra) applications with reactivity to human, mouse, rat samples CL488-66039 targets CPT1A in FC (Intra) applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive FC (Intra) detected in: HeLa cells Recommended dilution Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information CPT1A, also named as CPT1, CPT1-L and L-CPTI, belongs to the carnitine/choline acetyltransferase family. It is Localized Chromosome 11q13.1-2. Carnitine palmitoyltransferase (CPT) deficiencies are common disorders of mitochondrial fatty acid oxidation. The CPT system is made up of two separate proteins located in the outer (CPT1) and inner (CPT2) mitochondrial membranes. CPT1A is an active forms of related liver-type carnitine palmitoyltransferase I. (PMID: 11001805). CPT1A deficiency presents as recurrent attacks of fasting hypoketotic hypoglycemia. (PMID: 15363638). This antibody can bind the close sequences genes. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7745 Product name: Recombinant human CPT1A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 406-756 aa of BC000185 Sequence: QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETGIISQGPSSDT Predict reactive species Full Name: carnitine palmitoyltransferase 1A (liver) Calculated Molecular Weight: 88 kDa Observed Molecular Weight: 86 kDa GenBank Accession Number: BC000185 Gene Symbol: CPT1A Gene ID (NCBI): 1374 RRID: AB_2919280 Conjugate: CoraLite® Plus 488 Fluorescent Dye Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: P50416 Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924