Iright
BRAND / VENDOR: Proteintech

Proteintech, CL594-85789-2, CoraLite®594-conjugated DDX18 Recombinant monoclonal antibody

CATALOG NUMBER: CL594-85789-2
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100ul The DDX18 (CL594-85789-2) by Proteintech is a Recombinant antibody targeting DDX18 in IF/ICC applications with reactivity to human samples CL594-85789-2 targets DDX18 in IF/ICC applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information DDX18 (DEAD-box helicase 18) is a protein belonging to the DEAD-box deconjugating enzyme family that is widely involved in RNA metabolism. It plays a key role in the assembly of the ribosomal small subunit (SSU) and ensures efficient intracellular protein synthesis. DDX18 unwinds RNA double strands through its deconjugating enzyme activity, which is essential for the proper processing and functional execution of RNA molecules. In addition, DDX18 is a multifunctional RNA deconjugating enzyme involved in a variety of signaling pathways, playing a key role not only in ribosome assembly and RNA metabolism, but also in the regulation of a variety of biological processes such as cell cycle, genome stability and stem cell pluripotency. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag27457 Product name: Recombinant human DDX18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-165 aa of BC001238 Sequence: KLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEESAETTKETENNVEKPDNDEDESEVPS Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 18 Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC001238 Gene Symbol: DDX18 Gene ID (NCBI): 8886 Conjugate: CoraLite®594 Fluorescent Dye Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NVP1 Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924