Iright
BRAND / VENDOR: Proteintech

Proteintech, G10904-1-5C, MultiPro® 5CFLX Anti-Human IBA1 (Polyclonal)

CATALOG NUMBER: G10904-1-5C
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 10ug The IBA1 (G10904-1-5C) by Proteintech is a Polyclonal antibody targeting IBA1 in Single Cell (Intra) applications with reactivity to Human samples G10904-1-5C targets IBA1 in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information What is the molecular weight of IBA1?The molecular weight of IBA1 is 16.7 kD.What is IBA1?Ionized calcium-binding adaptor molecule 1 (IBA1), also known as Allograft inflammatory factor-1 (AIF-1), is an inflammation-responsive scaffold protein expressed and secreted from macrophages. Microglia response factor (MRF-1) and daintain are also similar, and likely identical, proteins (PMIDs: 29749461, 9630473, 23792284).What is the function of IBA1?IBA1 is necessary for macrophage survival, and it is also a key molecule in proinflammatory activity (PMID: 29749461).Where is IBA1 localized?IBA1 is a cytoplasmic protein, often expressed in immunocytes, macrophages, and microglia. It can be used as a marker for normal (not 'dark') microglia in brain tissue, as IBA1 is expressed by all microglial cell subpopulations (PMIDs: 29749461, 11943136, 26847266, 9630473).Is IBA1 upregulated in active immunophages?Yes; its expression is associated with inflammatory activity (PMID: 29749461).How do IBA1-positive microglia differ from microglia that express less or no IBA1?'Dark' microglia is a recently described phenotype associated with Alzheimer's disease pathology and chronic stress; these dark microglia express decreased IBA1 (often punctiform), and show distinct ultrastructural differences from 'normal' microglia as well as condensed and electron-dense cytoplasm and nucleoplasm. Normal microglia generally display strong, diffuse expression of IBA1. IBA1-positive microglial processes in normal conditions also have a strong tendency to exclusively contact synaptic elements, such as axon terminals, dendritic spines, and synaptic clefts (PMIDs: 29992181, 26847266).How is IBA1 related to Alzheimer's disease and pain?Exacerbated immunoactivity of IBA1, particularly in proximity to amyloid plaques, is prominently featured in AD pathology. IBA1, along with other microglial markers, are also associated with pain, and robust microglial reactions often follow spinal cord injury (PMIDs: 29992181, 23792284). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Oligo Conjugate Type: Polyclonal Immunogen: CatNo: Ag1363 Product name: Recombinant human IBA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC009474 Sequence: MSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human IBA1 (Polyclonal) Calculated Molecular Weight: 17 kDa GenBank Accession Number: BC009474 Gene Symbol: IBA1 Gene ID (NCBI): 199 ENSEMBL Gene ID: ENSG00000204472 RRID: AB_3673881 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGGGATAGGTGCCGACACCCATATAAGAAA Barcode Sequence: GGATAGGTGCCGACA Form: Liquid UNIPROT ID: P55008 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924