Proteintech, G17626-1-5C, MultiPro® 5CFLX Anti-Human CD127/IL-7R (Polyclonal)

Size: 10ug The CD127/IL-7R (G17626-1-5C) by Proteintech is a Polyclonal antibody targeting CD127/IL-7R in Single Cell (Intra) applications with reactivity to Human samples G17626-1-5C targets CD127/IL-7R in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information CD127, also known as IL-7R subunit alpha (IL-7RA), is a type I membrane glycoprotein expressed on thymocytes, B cell precursors, most T cells, and some lymphoid and myeloid cells. IL-7R is a heterodimer composed of CD127 and the common-γ chain receptor (CD132). IL-7R plays critical roles in lymphocyte development and homeostasis. CD127 can also act as a receptor for thymic stromal lymphopoietin (TSLP). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Oligo Conjugate Type: Polyclonal Immunogen: CatNo: Ag11844 Product name: Recombinant human IL-7R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 266-459 aa of BC067537 Sequence: KRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSPSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFSLQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human CD127/IL-7R (Polyclonal) Calculated Molecular Weight: 459 aa, 52 kDa GenBank Accession Number: BC067537 Gene Symbol: CD127 Gene ID (NCBI): 3575 ENSEMBL Gene ID: ENSG00000168685 RRID: AB_3673892 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGCGGCTCGGACCATAGCCCATATAAGAAA Barcode Sequence: CGGCTCGGACCATAG Form: Liquid UNIPROT ID: P16871 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.