Iright
BRAND / VENDOR: Proteintech

Proteintech, G22167-1-5C, MultiPro® 5CFLX Anti-Human IQGAP1 (Polyclonal)

CATALOG NUMBER: G22167-1-5C
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 10ug The IQGAP1 (G22167-1-5C) by Proteintech is a Polyclonal antibody targeting IQGAP1 in Single Cell (Intra) applications with reactivity to Human samples G22167-1-5C targets IQGAP1 in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information IQGAP1 is a member of a family of scaffolding proteins that interact with signaling and structural molecules. It localizes to sites of cell-cell contact in epithelial cells and regulates distinct cellular processes including cell adhesion, cell migration, extracellular signals through interacting with numerous protein. Multiple studies have shown that IQGAP1 is up-regulated in many human malignancies, such as lung cancer, ovarian cancer, colon cancer, breast cancer, melanoma and HCC. And IQGAP1 plays a critical role in cancer cell invasion. Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Oligo Conjugate Type: Polyclonal Immunogen: CatNo: Ag17821 Product name: Recombinant human IQGAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 478-827 aa of BC151834 Sequence: QLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRD Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human IQGAP1 (Polyclonal) Calculated Molecular Weight: 189 kDa GenBank Accession Number: BC151834 Gene Symbol: IQGAP1 Gene ID (NCBI): 8826 ENSEMBL Gene ID: ENSG00000140575 RRID: AB_3673894 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGTAGCGTCTATAGCCACCCATATAAGAAA Barcode Sequence: TAGCGTCTATAGCCA Form: Liquid UNIPROT ID: P46940 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924