Iright
BRAND / VENDOR: Proteintech

Proteintech, G66427-1-5C, MultiPro® 5CFLX Anti-Human STAT5B (1D9B11)

CATALOG NUMBER: G66427-1-5C
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 10ug The STAT5B (G66427-1-5C) by Proteintech is a Monoclonal antibody targeting STAT5B in Single Cell (Intra) applications with reactivity to Human samples G66427-1-5C targets STAT5B in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information STAT5B belongs to the transcription factor STAT family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT5B carries out a dual function: signal transduction and activation of transcription. STAT5B mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different GH. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. Despite the 95% homology between the immunogen (Ag2709) and the STAT5A protein, our WB detection showed that this antibody does not recognize the STAT5A fusion protein (Ag19546). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Oligo Conjugate Type: Monoclonal Immunogen: CatNo: Ag2709 Product name: Recombinant human STAT5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC020868 Sequence: MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAAT Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human STAT5B (1D9B11) Calculated Molecular Weight: 787 aa, 90 kDa GenBank Accession Number: BC020868 Gene Symbol: STAT5B Gene ID (NCBI): 6777 ENSEMBL Gene ID: ENSG00000173757 RRID: AB_3673954 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGCTCCTATTGGAGTGGCCCATATAAGAAA Barcode Sequence: CTCCTATTGGAGTGG Form: Liquid UNIPROT ID: P51692 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924