Iright
BRAND / VENDOR: Proteintech

Proteintech, G67722-1-5C, MultiPro® 5CFLX Anti-Human GATA2 (2B5A1)

CATALOG NUMBER: G67722-1-5C
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 10ug The GATA2 (G67722-1-5C) by Proteintech is a Monoclonal antibody targeting GATA2 in Single Cell (Intra) applications with reactivity to Human samples G67722-1-5C targets GATA2 in Single Cell (Intra) applications and shows reactivity with Human samples. Tested Applications Positive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product. Recommended dilution SINGLE CELL (INTRA): <0.5ug/test Background Information GATA2 is a member of GATA family of transcription factors that contains zinc fingers in DNA binding domain. GATA2 acts as a transcriptinal activator that regulates endothelin-1 expression in endothelial cells. Together with GATA3, GATA2 regulates adipocyte differentiation through molecular control of the preadpocyte-adipocyte transition. It also affect the activity of Rho inhibitor p190RhoGAP that controls capillary network formation in vitro and retinal angiogenesis in vivo. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Oligo Conjugate Type: Monoclonal Immunogen: CatNo: Ag1557 Product name: Recombinant human GATA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 168-467 aa of BC018988 Sequence: SHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG Predict reactive species Full Name: MultiPro® 5CFLX Anti-Human GATA2 (2B5A1) GenBank Accession Number: BC018988 Gene Symbol: GATA2 Gene ID (NCBI): 2624 ENSEMBL Gene ID: ENSG00000179348 RRID: AB_3673967 Conjugate: 5CFLX Full Oligo Sequence: CGGAGATGTGTATAAGAGACAGTCACGCCGTCACGAGCCCATATAAGAAA Barcode Sequence: TCACGCCGTCACGAG Form: Liquid UNIPROT ID: P23769 Storage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3. Storage Conditions: 2-8°C Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924