Iright
BRAND / VENDOR: Proteintech

Proteintech, PE-FcA98110, FcZero-rAb™ PE Anti-Human MICA/MICB Rabbit Recombinant Antibody

CATALOG NUMBER: PE-FcA98110
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 100tests The MICA/MICB (PE-FcA98110) by Proteintech is a Recombinant antibody targeting MICA/MICB in FC applications with reactivity to human samples PE-FcA98110 targets MICA/MICB in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: HeLa cells Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in 100 μl suspension Background Information Human MHC class I chain-related genes located within the HLA class I region of chromosome 6 encode MHC class I chain-related A and B (MICA and MICB) (PMID: 11429322). MICA and MICB are stress-inducible surface molecules that are not associated with β2-microglobulin and do not present peptides (PMID: 9497295). They are expressed in intestinal epithelium and many epithelial tumors (PMID: 10359807). MICA and MICB are ligands for NKG2D which is an activating receptor that is expressed on most natural killer (NK) cells, CD8 αβ T cells, and γδ T cells (PMID: 10426993; 11491531). This antibody recognizes both MICA and MICB. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1176 Product name: Recombinant Human MICA protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 24-308 aa of / Sequence: EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ Predict reactive species Full Name: MHC class I polypeptide-related sequence A Calculated Molecular Weight: 43 kDa GenBank Accession Number: / Gene Symbol: MICA Gene ID (NCBI): 100507436 Conjugate: PE Fluorescent Dye Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q29983 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924