Proteintech, PE-FcA98157, FcZero-rAb™ PE Anti-Human CRTAM/CD355 Rabbit Recombinant Antibody

Size: 100tests The CRTAM/CD355 (PE-FcA98157) by Proteintech is a Recombinant antibody targeting CRTAM/CD355 in FC applications with reactivity to human samples PE-FcA98157 targets CRTAM/CD355 in FC applications and shows reactivity with human samples. Tested Applications Positive FC detected in: PMA and ionomycin treated human PBMCs Recommended dilution Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension Background Information Cytotoxic and regulatory T cell molecule (CRTAM, also known as CD355) is an immunoglobulin-superfamily transmembrane protein with V and C1-like Ig domains, which is involved in epithelial cell adhesion (PMID: 18329370; 20556794). CRTAM is critical to instruct the differentiation of CD4+ cytotoxic T cells (CTL) through the induction of eomesodermin and CTL-related genes (PMID: 26694968). It also regulates CD8+ T cell retention within the lymph node and eventually effector function (PMID: 19752223). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1541 Product name: Recombinant Human CRTAM protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 18-286 aa of NM_019604.4 Sequence: SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKS Predict reactive species Full Name: cytotoxic and regulatory T cell molecule Calculated Molecular Weight: 45 kDa GenBank Accession Number: NM_019604.4 Gene Symbol: CRTAM Gene ID (NCBI): 56253 Conjugate: PE Fluorescent Dye Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95727-1 Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.