Proteintech, 10197-1-AP, HDAC1 Polyclonal antibody

Size: 20ul / 150ul The HDAC1 (10197-1-AP) by Proteintech is a Polyclonal antibody targeting HDAC1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 10197-1-AP targets HDAC1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C6 cells, HeLa cells, mouse testis tissue, Jurkat cells, K-562 cells, NIH/3T3 cells Positive IP detected in: HeLa cells Positive IHC detected in: mouse colon tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:8000-1:20000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information BackgroundHistone Deacetylase 1 (HDAC1) is a nuclear localized class I histone deacetylase that plays a role in the regulation of gene expression, mainly by repression of gene activity. Additionally, HDAC can mediate deacetylation of a subset of non-histone proteins, leading to their degradation. HDAC1 activity has an impact on cell growth, proliferation, and death.1. What is the molecular weight of HDAC1?The molecular size of HDAC1 is 60 kDa.2. What is the subcellular localization of HDAC1?Unlike some HDACs, HDAC1 is present entirely in the nucleus. Our HDAC1 antibody has been broadly tested for IF/ICC.3. I cannot detect an HDAC1 specific signal in my sample during western blotting.Make sure that you efficiently extract nuclear proteins during your sample preparation. Some lysis buffers (e.g., based on Triton X-100) may not extract nuclear proteins. We recommend using RIPA buffer (https://www.ptglab.com/support/protocols/). We highly recommend using nuclear loading control antibodies, such as lamin B1 or PCNA (https://www.ptglab.com/news/blog/loading-control-antibodies-for-western-blotting/). Alternatively, you may consider performing cell fractionation.4. How do I perform chromatin immunoprecipitation (ChiP) with the HDAC1 antibody?We recommend using our standard chromatin immunoprecipitation protocol (https://www.ptglab.com/media/2708/web_chip-protocol.pdf).5. Is HDAC1 post-translationally modified?HDAC1 is a protein deacetylase but itself can also be a subject of post-translational modifications, including phosphorylation, acetylation, ubiquitination, SUMOylation, nitrosylation, and carbonylation (PMID: 21197454).6. What is the role of HDAC1 in cancer?The acetylation and deacetylation of histones play an important part in the epigenetic regulation of gene expression. Alterations in the balance between these two opposing processes changes chromosome remodeling and increased deacetylation leads to gene silencing. HDAC1 levels are increased in many cancer cell types and the role of HDAC1 in cancer is connected not only to histone deacetylation but also to the deacetylation of other proteins, such as Rb family proteins, estrogen receptors, and p53 protein (PMID: 19383284). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0256 Product name: Recombinant human HDAC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-482 aa of BC000301 Sequence: EEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA Predict reactive species Full Name: histone deacetylase 1 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC000301 Gene Symbol: HDAC1 Gene ID (NCBI): 3065 RRID: AB_2118062 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13547 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.