Iright
BRAND / VENDOR: Proteintech

Proteintech, 10208-1-AP, EFTUD2 Polyclonal antibody

CATALOG NUMBER: 10208-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EFTUD2 (10208-1-AP) by Proteintech is a Polyclonal antibody targeting EFTUD2 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 10208-1-AP targets EFTUD2 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA, PLA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information EFTUD2 encodes the 116 kDa U5 small nuclear ribonecleoprotein (snRNP) component, also named SNU114, it has GTP binding activity and is required for pre-mRNA splicing. Evolutionarily conserved human snRNP protein (U5-116kDa) is homologous to the ribosomal elongation factor EF-2 (ribosomal translocase). Defects in EFTUD2 are the cause of mandibulofacial dysostosis with microcephaly (MFDM). So far, acetylation and phosphorylation sites of EFTUD2 have been identified. Catolog#10208-1-AP is a rabbit polyclonal antibody raised against the N-terminal of human EFTUD2. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0279 Product name: Recombinant human EFTUD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-217 aa of BC002360 Sequence: IGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTA Predict reactive species Full Name: elongation factor Tu GTP binding domain containing 2 Calculated Molecular Weight: 116 kDa Observed Molecular Weight: 116 kDa GenBank Accession Number: BC002360 Gene Symbol: EFTUD2 Gene ID (NCBI): 9343 RRID: AB_2095834 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15029 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924