Iright
BRAND / VENDOR: Proteintech

Proteintech, 10214-1-Ig, TSC22D1 Polyclonal antibody

CATALOG NUMBER: 10214-1-Ig
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TSC22D1 (10214-1-Ig) by Proteintech is a Polyclonal antibody targeting TSC22D1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, rat samples 10214-1-Ig targets TSC22D1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: human brain tissue, A549 cells, rat brain tissue Positive IP detected in: rat brain tissue Positive IHC detected in: human brain tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TSC22 domain family 1, transforming growth factor beta 1 induced transcript 4, (TSC22D1, synonyms: TSC22, TGFB1I4, MGC17597) is a member of a family of leucine zipper containing transcription factors with repressor activity and belongs to the large family of early response genes. TSC-22 regulates cell growth and differentiation, and cell death. Leucine zipper structure of TSC22 inhibits the anchorage independent growth of cancer cells. TSC-22 is also an important downstream component of peroxisome proliferator-activated receptor (PPAR) and TGF-beta signaling during intestinal epithelial cell differentiation. This antibody is a rabbit polyclonal antibody raised against an internal region of human TSC22D1. Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0287 Product name: Recombinant human TSC22D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-144 aa of BC000456 Sequence: KSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA Predict reactive species Full Name: TSC22 domain family, member 1 Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC000456 Gene Symbol: TSC22D1 Gene ID (NCBI): 8848 RRID: AB_2272193 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15714 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924