Iright
BRAND / VENDOR: Proteintech

Proteintech, 10442-1-AP, P53 Polyclonal antibody

CATALOG NUMBER: 10442-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The P53 (10442-1-AP) by Proteintech is a Polyclonal antibody targeting P53 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, rat samples 10442-1-AP targets P53 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: A431 cells, SMMC-7721 cells, MCF-7 cells, rat colon tissue, HEK-293 cells, HT-29 cells, HepG2 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information 1.       What is p53?P53 is a tumor suppressor gene that plays a role in maintaining genomic stability and controlling apoptosis. During the cell cycle, it can arrest cells at the G1/S checkpoint and activate DNA repair mechanisms. It is the most mutated gene in cancer. In unstressed cells, p53 usually exists at low levels in an inactive form, being bound to Mdm2.2.       FAQs and p53a.I fail to detect p53 by western blottingBasal levels of wild-type p53 in untreated cells can be low. Try to load more cell lysate and use a positive control - a lysate of cells treated with DNA-damaging agents should increase p53 levels.b.I fail to detect p53 in some cell lines by western blottingVarious p53 mutations are present in cancer cell types. If mutations cause truncations/deletions some monoclonal antibodies may no longer recognize mutated p53. You have more chances of detecting various p53 mutants with our polyclonal antibody.c.I can detect more than one band ~50 kDa size / different cell lines give bands at slightly different sizep53 is a subject of post-translational modifications (http://p53.free.fr/p53_info/p53_modifications.html) and more than one isoform may be expressed (http://p53.free.fr/p53_info/p53_isoforms.html). Also, it is possible that your cell line of interest expresses one allele with mutated p53 with altered molecular weight. Specification Tested Reactivity: human, rat Cited Reactivity: human, rat, pig, rabbit, monkey, chicken, zebrafish, sheep, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0698 Product name: Recombinant human P53 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-232 aa of BC003596 Sequence: MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTI Predict reactive species Full Name: tumor protein p53 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC003596 Gene Symbol: P53 Gene ID (NCBI): 7157 RRID: AB_2206609 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04637 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924