Proteintech, 10756-1-AP, UQCRB Polyclonal antibody

Size: 20ul / 150ul The UQCRB (10756-1-AP) by Proteintech is a Polyclonal antibody targeting UQCRB in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 10756-1-AP targets UQCRB in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: human breast cancer tissue, human kidney tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information UQCRB(ubiquinol-cytochrome c reductase binding protein) is also named as UQBP, complex III subunit VII and belongs to the UQCRB/QCR7 family. It is a 13.4 kDa subunit of mitochondrial complex III, plays a crucial role in hypoxia-induced angiogenesis via mitochondrial reactive oxygen species (ROS)-mediated signaling(PMID:21215626). This protein has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1127 Product name: Recombinant human UQCRB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-111 aa of BC005230 Sequence: MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK Predict reactive species Full Name: ubiquinol-cytochrome c reductase binding protein Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC005230 Gene Symbol: UQCRB Gene ID (NCBI): 7381 RRID: AB_2304256 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14927 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.