Iright
BRAND / VENDOR: Proteintech

Proteintech, 10774-1-AP, SFTPC Polyclonal antibody

CATALOG NUMBER: 10774-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SFTPC (10774-1-AP) by Proteintech is a Polyclonal antibody targeting SFTPC in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 10774-1-AP targets SFTPC in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, rat lung tissue Positive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information SFTPC (surfactant protein C), also named as SFTP2, SP5 and SP-C, is a pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. Defects in SFTPC are the cause of pulmonary surfactant metabolism dysfunction type 2 (SMDP2). Genetic variations in SFTPC are associated with respiratory distress syndrome in premature infants (RDS). Two isoforms of the human protein are produced by alternative splicing. One previous study reported that SFTPC deletion was observed in NSCLC tissues, implying that SFTPC downregulation might be involved in the progression of lung cancer. (PMID: 35081981, PMID: 31379200) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1159 Product name: Recombinant human SFTPC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-197 aa of BC005913 Sequence: MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI Predict reactive species Full Name: surfactant protein C Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21-25 kDa GenBank Accession Number: BC005913 Gene Symbol: SFTPC Gene ID (NCBI): 6440 RRID: AB_2185497 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11686 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924