Iright
BRAND / VENDOR: Proteintech

Proteintech, 11194-1-AP, AKR1C3 Polyclonal antibody

CATALOG NUMBER: 11194-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AKR1C3 (11194-1-AP) by Proteintech is a Polyclonal antibody targeting AKR1C3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 11194-1-AP targets AKR1C3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HepG2 cells, Jurkat cells, K-562 cells Positive IP detected in: HepG2 cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:112-1:450 Background Information AKR1C3(Aldo-keto reductase family 1 member C3) is also named as DDH1, HSD17B5, KIAA0119, PGFS and belongs to AKR1C family. .In humans, at least four AKR1C isoforms exist: AKR1C1, AKR1C2, AKR1C3, AKR1C4 and AKR1C3 shares >86% sequence identity with these three highly related human AKRs(PMID:18574251). It catalyzes the conversion of aldehydes and ketones to alcohols and androgen, estrogen, PG, xenobiotics metabolism. The rat kidney possesses a dimeric form of 75 kDa(PMID:18574251). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag1674 Product name: Recombinant human AKR1C3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-323 aa of BC019230 Sequence: MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY Predict reactive species Full Name: aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II) Calculated Molecular Weight: 323 aa, 37 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC019230 Gene Symbol: AKR1C3 Gene ID (NCBI): 8644 RRID: AB_2224414 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P42330 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924