Iright
BRAND / VENDOR: Proteintech

Proteintech, 11546-1-AP, NMT1 Polyclonal antibody

CATALOG NUMBER: 11546-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NMT1 (11546-1-AP) by Proteintech is a Polyclonal antibody targeting NMT1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 11546-1-AP targets NMT1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SKOV-3 cells, PC-3 cells, mouse pancreas tissue, HeLa cells, L02 cells, human kidney tissue Positive IP detected in: HeLa cells Positive IHC detected in: mouse kidney tissue, human heart tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NMT1 is a N-myristoyltransferase responsible for the transfer of myristate from CoA to an amino-terminal glycine of many eukaryotic proteins, which facilitates the targeting of proteins to membrane surfaces and is essential for viability of the organism. Insertional mutagenesis of the Nmt1 gene in Saccharomyces cerevisiae causes recessive lethality. Humans and mice possess two distinct but structurally similar enzymes, NMT1 and NMT2, ubiquitously expressed in most human and mouse tissues. Western analysis revealed that there are 4 isoforms of NMT1 with apparent molecular masses ranging from 49 to 68 kDa. In cell fractionation studies, the 68-kDa NMT1 isoform and NMT2 were present in both membrane and cytoplasmic fractions, while the smaller NMT1 isoforms were predominantly cytoplasmic. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2072 Product name: Recombinant human NMT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC006569 Sequence: MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKKQKKKKEKGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSL Predict reactive species Full Name: N-myristoyltransferase 1 Calculated Molecular Weight: 496 aa, 57 kDa Observed Molecular Weight: 49-68 kDa GenBank Accession Number: BC006569 Gene Symbol: NMT1 Gene ID (NCBI): 4836 RRID: AB_2153157 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30419 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924