Iright
BRAND / VENDOR: Proteintech

Proteintech, 11727-3-AP, IFITM1 Polyclonal antibody

CATALOG NUMBER: 11727-3-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IFITM1 (11727-3-AP) by Proteintech is a Polyclonal antibody targeting IFITM1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 11727-3-AP targets IFITM1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, TF-1 cells Positive IP detected in: ROS1728 cells Positive IHC detected in: human lymphoma tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information IFITM1(interferon induced transmembrane protein), also named DSPA2a or interferon-induced protein 17 (IFI17), belongs to the CD225 family. It has two transmembrane domain and serves as an IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, influenza A H1N1 virus, West Nile virus (WNV), and dengue virus , by inhibiting the early steps of replication. IFITM proteins are recently identified as viral restriction factors that inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. Also they serve as important components of the innate immune system to restrict HIV-1 infection. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, pig, goat, african green monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2320 Product name: Recombinant human IFITM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC000897 Sequence: MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY Predict reactive species Full Name: interferon induced transmembrane protein 1 (9-27) Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 14-17 kDa GenBank Accession Number: BC000897 Gene Symbol: IFITM1 Gene ID (NCBI): 8519 RRID: AB_2122083 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13164 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924