Proteintech, 11774-1-AP, RBP4 Polyclonal antibody

Size: 20ul / 150ul The RBP4 (11774-1-AP) by Proteintech is a Polyclonal antibody targeting RBP4 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 11774-1-AP targets RBP4 in WB, IHC, IF/ICC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human blood, HepG2 cells, human plasma Positive IHC detected in: mouse eye tissue, human liver cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse eye tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:187-1:750 Background Information RBP4 (retinol-binding protein 4) is a carrier protein that transports vitamin A (retinol) from the liver to the peripheral tissues. Synthesized primarily by hepatocytes and adipocytes as a 21 kDa non-glycosylated protein, RBP4 is secreted into the circulation as a retinol-RBP4 complex. In plasma the RBP4-retinol complex is bound to transthyretin (TRR), which prevents kidney filtration. Two truncated forms of RBP4, RBP4-L (truncated at Leu-183) and RBP4-LL (truncated at Leu-182 and Leu-183), exist by proteolytic process. RBP4-L and RBP4-LL, which do not bind TTR, are normally excreted into the urine but accumulate in the serum during renal failure. Urinary RBP4 has been reported as marker for glomerular disease. RBP4 also was identified as an adipokine that elevated in some INS-resistant states. Measurement of serum RBP4 could be used to assess the risk of INS resistance, type 2 diabetes, obesity, and cardiovascular disease. (18752671, 16034410) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, geese, camelus bactrianus Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2448 Product name: Recombinant human RBP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC020633 Sequence: MKWVWALFLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYCDGRSERNLL Predict reactive species Full Name: retinol binding protein 4, plasma Calculated Molecular Weight: 201 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC020633 Gene Symbol: RBP4 Gene ID (NCBI): 5950 RRID: AB_2252700 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02753 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.