Iright
BRAND / VENDOR: Proteintech

Proteintech, 12005-1-AP, AVPI1 Polyclonal antibody

CATALOG NUMBER: 12005-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AVPI1 (12005-1-AP) by Proteintech is a Polyclonal antibody targeting AVPI1 in IHC, ELISA applications with reactivity to human samples 12005-1-AP targets AVPI1 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information AVPI1, also named as NPD013 and PP5395, is an arginine vasopressin-induced protein. It may be involved in MAP kinase activation, epithelial sodium channel (ENaC) down-regulation and cell cycling. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2626 Product name: Recombinant human AVPI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-147 aa of BC000877 Sequence: MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTSYLHQIRH Predict reactive species Full Name: arginine vasopressin-induced 1 Calculated Molecular Weight: 21.5 kDa GenBank Accession Number: BC000877 Gene Symbol: AVPI1 Gene ID (NCBI): 60370 RRID: AB_3085385 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T686 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924