Iright
BRAND / VENDOR: Proteintech

Proteintech, 12110-1-AP, PADI2 Polyclonal antibody

CATALOG NUMBER: 12110-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PADI2 (12110-1-AP) by Proteintech is a Polyclonal antibody targeting PADI2 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 12110-1-AP targets PADI2 in WB, IHC, IF/ICC, IF-P, IP, COIP, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, MCF-7 cells, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue Positive IF/ICC detected in: BxPC-3 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information PADI2, also named as KIAA0994, PDI2, PAD-H19, and PAD2(Peptidylarginine deiminase II ), belongs to the protein arginine deiminase family. It catalyzes the deimination of arginine residues of proteins. PADI2 may play a regulatory role in the expression of lactation-related genes via histone citrullination during diestrus (PMID:20668670). PADI2 has two isoforms with MW 75 kDa and 49 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2755 Product name: Recombinant human PADI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-438 aa of BC009701 Sequence: ISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMTPNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPL Predict reactive species Full Name: peptidyl arginine deiminase, type II Calculated Molecular Weight: 665 aa, 75 kDa Observed Molecular Weight: 70-75 kDa, 50 kDa GenBank Accession Number: BC009701 Gene Symbol: PADI2 Gene ID (NCBI): 11240 RRID: AB_2159475 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2J8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924