Proteintech, 12112-1-AP, AP1M1 Polyclonal antibody

Size: 20ul / 150ul The AP1M1 (12112-1-AP) by Proteintech is a Polyclonal antibody targeting AP1M1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 12112-1-AP targets AP1M1 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, Hacat cells Positive IP detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information AP1M1, also named as CLTNM, Mu-adaptin 1 and Clathrin coat assembly protein AP47, belongs to the adaptor complexes medium subunit family. It is a subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2757 Product name: Recombinant human AP1M1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 164-423 aa of BC017469 Sequence: IKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ Predict reactive species Full Name: adaptor-related protein complex 1, mu 1 subunit Calculated Molecular Weight: 423 aa, 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC017469 Gene Symbol: AP1M1 Gene ID (NCBI): 8907 RRID: AB_2058339 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXS5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.