Iright
BRAND / VENDOR: Proteintech

Proteintech, 12125-1-AP, RAB22A Polyclonal antibody

CATALOG NUMBER: 12125-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RAB22A (12125-1-AP) by Proteintech is a Polyclonal antibody targeting RAB22A in WB, IP, IHC, ELISA applications with reactivity to human samples 12125-1-AP targets RAB22A in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, Jurkat cells, BxPC-3 cells, A375 cells Positive IP detected in: COLO 320 cells Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RAB22A is a small GTPase that is expressed ubiquitously in mammalian tissues. It localizes in the MHCI-containing recycling endosomal tubules and functions in endocytic pathway. RAB22A may regulate the dynamic interactions of endosomal compartments and it may be involved in the communication between the biosynthetic and early endocytic pathways. It shares 81% identity with RAB31. Specification Tested Reactivity: human Cited Reactivity: human, mouse, canine, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2769 Product name: Recombinant human RAB22A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC015710 Sequence: MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRSCC Predict reactive species Full Name: RAB22A, member RAS oncogene family Calculated Molecular Weight: 194 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC015710 Gene Symbol: RAB22A Gene ID (NCBI): 57403 RRID: AB_2173765 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UL26 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924