Iright
BRAND / VENDOR: Proteintech

Proteintech, 12336-1-AP, FAM3D Polyclonal antibody

CATALOG NUMBER: 12336-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM3D (12336-1-AP) by Proteintech is a Polyclonal antibody targeting FAM3D in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12336-1-AP targets FAM3D in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, rat colon tissue Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FAM3 (family with sequence similarity 3) is a cytokine-like family consisting of four members, FAM3A, FAM3B, FAM3C, and FAM3D, who share a 4-helical bundle structure. FAM3D is constitutively expressed in the gastrointestinal tract and is regulated by nutritional status. FAM3D controls blood sugar levels by acting as an insulin-sensitizing protein and improves lipid deposition in the liver. (PMID: 22226334; PMID: 37328068) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag2965 Product name: Recombinant human FAM3D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-204 aa of BC015359 Sequence: RSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTN Predict reactive species Full Name: family with sequence similarity 3, member D Calculated Molecular Weight: 224 aa, 24 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC015359 Gene Symbol: FAM3D Gene ID (NCBI): 131177 RRID: AB_10667402 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96BQ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924