Iright
BRAND / VENDOR: Proteintech

Proteintech, 12408-1-AP, GEMIN4 Polyclonal antibody

CATALOG NUMBER: 12408-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GEMIN4 (12408-1-AP) by Proteintech is a Polyclonal antibody targeting GEMIN4 in WB, IP, ELISA applications with reactivity to human samples 12408-1-AP targets GEMIN4 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Positive IP detected in: HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information GEMIN4, also named as P97, is a sub-unit of SMN complex. The SMN complex plays a catalyst role in the assembly of small nuclear ribonucleoproteins (snRNPs). It plays an important role in the splicing of cellular pre-mRNAs. The express amount of GEMIN4 is about 8.79 ppm (http://pax-db.org/#!protein/984742). This antibody detects 97-110 kDa GEMIN4. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3099 Product name: Recombinant human GEMIN4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 703-1058 aa of BC020062 Sequence: QLLDRFSKYWQLPKEKRCLSLDRKDLAIHILELLCEIVSANAETFSPDVWIKSLSWLHRKLEQLDWTVGLRLKSFFEGHFKCEVPATLFEICKLSEDEWTSQAHPGYGAGTGLLAWMECCCVSSGISERMLSLLVVDVGNPEEVRLFSKGFLVALVQVMPWCSPQEWQRLHQLTRRLLEKQLLHVPYSLEYIQFVPLLNLKPFAQELQLSVLFLRTFQFLCSHSCRNWLPLEGWNHVVKLLCGSLTRLLDSVRAIQAAGPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLSIETLTCYETLSKTNPSVSSLRSRAHEQRFLKSIAEGIGPEERRQTLLQKMSSF Predict reactive species Full Name: gem (nuclear organelle) associated protein 4 Calculated Molecular Weight: 1058 aa, 120 kDa Observed Molecular Weight: 120-130 kDa GenBank Accession Number: BC020062 Gene Symbol: GEMIN4 Gene ID (NCBI): 50628 RRID: AB_10640891 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P57678 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924