Iright
BRAND / VENDOR: Proteintech

Proteintech, 12486-1-AP, CYP46A1 Polyclonal antibody

CATALOG NUMBER: 12486-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CYP46A1 (12486-1-AP) by Proteintech is a Polyclonal antibody targeting CYP46A1 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 12486-1-AP targets CYP46A1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Cytochrome P450 46A1 (CYP46A1), also named as CYP46, P450 46A1, CH24H and Cholesterol 24-hydroxylase, belongs to the cytochrome P450 family. CYP46A1 is a central nervous system-specific enzyme, and can freely cross the blood-brain barrier and be degraded in the liver. It is involved in the turnover of cholesterol. It converts cholesterol into 24S-hydroxycholesterol and, to a lesser extent, 25-hydroxycholesterol. CYP46A1 is significantly upregulated in hepatic lymphomyeloid cells compared with ESCs.(PMID:20039312) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3116 Product name: Recombinant human CYP46A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-500 aa of BC022539 Sequence: TSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC Predict reactive species Full Name: cytochrome P450, family 46, subfamily A, polypeptide 1 Calculated Molecular Weight: 500 aa, 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC022539 Gene Symbol: CYP46A1 Gene ID (NCBI): 10858 RRID: AB_2090661 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6A2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924