Iright
BRAND / VENDOR: Proteintech

Proteintech, 12527-1-AP, CHMP2B Polyclonal antibody

CATALOG NUMBER: 12527-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHMP2B (12527-1-AP) by Proteintech is a Polyclonal antibody targeting CHMP2B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12527-1-AP targets CHMP2B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NIH/3T3 cells, human heart tissue, mouse brain tissue, human ileum tissue, human kidney tissue, human placenta tissue, human brain tissue Positive IHC detected in: mouse brain tissue, human brain tissue, human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, PFA fixed cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CHMP2B, chromatin-modifying protein 2b, also named CHMP2.5, VPS2B, and VPS2 2, belongs to the chromatin-modifying protein / charged multivesicular body protein (CHMP) family. It is a component of the endosomal sorting complex required for transport III (ESCRT-III), which involves in endosomal and autophagic trafficking of proteins to lysosomes for degradation. Mutations of CHMP2B lead to C-terminal truncation or are replaced with mis-splicing C-termini and cause frontotemporal lobar degeneration (FTLD). In CHMP2B mutation patients, p62- and ubiquitin-positive, but TDP-43 and FUS negative neural inclusions are formed, which may be caused by impaired lysosomal degradation through the autophagy and endosome-lysosome pathways. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3222 Product name: Recombinant human CHMP2B protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-213 aa of BC001553 Sequence: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD Predict reactive species Full Name: chromatin modifying protein 2B Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC001553 Gene Symbol: CHMP2B Gene ID (NCBI): 25978 RRID: AB_10603358 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UQN3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924