Iright
BRAND / VENDOR: Proteintech

Proteintech, 12605-1-AP, GUCY1A3 Polyclonal antibody

CATALOG NUMBER: 12605-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GUCY1A3 (12605-1-AP) by Proteintech is a Polyclonal antibody targeting GUCY1A3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 12605-1-AP targets GUCY1A3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, human cerebellum tissue, human kidney tissue, mouse lung tissue Positive IP detected in: mouse lung tissue Positive IHC detected in: mouse heart tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Guanylate cyclase soluble subunit alpha-1 (GUCY1A3, also known as GUCY1A1, GCS-alpha-1, and GCS-alpha-3) is a lyase that plays a role in cGMP biosynthesis (PMID: 24155296). GUCY1A3 activation may be considered as a strategy to alleviate endothelial ferroptosis and cardiac microvascular reperfusion injury (PMID: 40856046). GUCY1A3 is also known to be associated with coronary artery disease and pulmonary artery hypertension (PMID: 24213632; 25373139). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3293 Product name: Recombinant human GUCY1A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 391-690 aa of BC028384 Sequence: EDFTGRGLYLSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMAVKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSEIPGICHFLDAYQQGTNSKPCFQKKDVEDGNANFLGKASGID Predict reactive species Full Name: guanylate cyclase 1, soluble, alpha 3 Calculated Molecular Weight: 690 aa, 77 kDa Observed Molecular Weight: 77 kDa GenBank Accession Number: BC028384 Gene Symbol: GUCY1A3 Gene ID (NCBI): 2982 RRID: AB_2248099 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02108 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924