Iright
BRAND / VENDOR: Proteintech

Proteintech, 12847-1-AP, ZMPSTE24 Polyclonal antibody

CATALOG NUMBER: 12847-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZMPSTE24 (12847-1-AP) by Proteintech is a Polyclonal antibody targeting ZMPSTE24 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 12847-1-AP targets ZMPSTE24 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells Positive IP detected in: PC-3 cells Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information ZMPSTE24(CAAX prenyl protease 1 homolog) gene encodes a zinc metalloproteinase involved in the processing of farnesylated proteins(PubMed: 10373325). The significance of ZMPSTE24 in human disease stems from its role as an enzyme necessary for the correct processing and maturation of lamin A ,an intermediate filament component of the nuclear envelope (PubMed: 16297189). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3949 Product name: Recombinant human ZMPSTE24 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 225-475 aa of BC037283 Sequence: TPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEEGNSEEIKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTMKQH Predict reactive species Full Name: zinc metallopeptidase (STE24 homolog, S. cerevisiae) Calculated Molecular Weight: 475 aa, 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC037283 Gene Symbol: ZMPSTE24 Gene ID (NCBI): 10269 RRID: AB_2257430 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75844 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924