Iright
BRAND / VENDOR: Proteintech

Proteintech, 13011-1-AP, ETV5 Polyclonal antibody

CATALOG NUMBER: 13011-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ETV5 (13011-1-AP) by Proteintech is a Polyclonal antibody targeting ETV5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13011-1-AP targets ETV5 in WB, IHC, IF/ICC, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, PC-3 cells, Raji cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ETS variant gene 5(ETV5) belongs to the ETS oncogene family that shares a conserved peptide, ETS domain, which mediates sequence-specific DNA binding. ETV5 is a transcription factor and is required for spermatogonial stem cell self-renewal. ETV5 can be negatively regulated by COP1, a tumor suppressor. Also it has a role in branching morphogenesis in the developing kidney Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3708 Product name: Recombinant human ETV5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 160-510 aa of BC007333 Sequence: SGHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYFSSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSPAYLLDMDRCSSLPYAEGFAY Predict reactive species Full Name: ets variant 5 Calculated Molecular Weight: 510 aa, 58 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC007333 Gene Symbol: ETV5 Gene ID (NCBI): 2119 RRID: AB_2278092 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P41161 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924