Proteintech, 13092-1-AP, MITF Polyclonal antibody

Size: 20ul / 150ul The MITF (13092-1-AP) by Proteintech is a Polyclonal antibody targeting MITF in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 13092-1-AP targets MITF in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells, mouse heart tissue, rat skin tissue, NIH/3T3 cells Positive IP detected in: mouse heart tissue Positive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information The retinal pigment epithelium (RPE) has a essential role in maintaining visual function and dedifferentiation of RPE contributes to the pathophysiology of several ocular diseases[PMID: 22523078]. Microphthalmia-associated transcription factor (MITF) is a key regulator of RPE differentiation that is also down-regulated in dedifferentiated hfRPE cells. MITF is a basic helix-loop-helix (hHLH)-leucine zipper protein that involves in the development of various cell types, including neural crest-derived melanocytes and optic cup-derived retinal pigment epithelial cells [PMID: 10578055]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3679 Product name: Recombinant human MITF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC012503 Sequence: MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEFMKQ Predict reactive species Full Name: microphthalmia-associated transcription factor Calculated Molecular Weight: 91 aa, 10 kDa, 59 kDa Observed Molecular Weight: 59-65 kDa GenBank Accession Number: BC012503 Gene Symbol: MITF Gene ID (NCBI): 4286 RRID: AB_10597698 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75030 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.