Iright
BRAND / VENDOR: Proteintech

Proteintech, 13381-1-AP, GLRX2 Polyclonal antibody

CATALOG NUMBER: 13381-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GLRX2 (13381-1-AP) by Proteintech is a Polyclonal antibody targeting GLRX2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13381-1-AP targets GLRX2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HGC-27 cells, MCF-7 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GLRX2(Glutaredoxin-2) is also named as GRX2 and belongs to the glutaredoxin family. It facilitates the maintenance of cellular redox homeostasis upon treatment with apoptotic agents, thereby preventing cardiolipin oxidation and cytochrome C release. The GLRX2, which exists in a dynamic equilibrium of enzymatically active monomers and quiescent dimers,is a 16-kDa protein directed either to the nucleus or to the mitochondria through differential splicing of the first exon(PMID: 17121859). It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4218 Product name: Recombinant human GLRX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC028113 Sequence: RSGSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ Predict reactive species Full Name: glutaredoxin 2 Calculated Molecular Weight: 164 aa, 18 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC028113 Gene Symbol: GLRX2 Gene ID (NCBI): 51022 RRID: AB_10643373 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NS18 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924