Iright
BRAND / VENDOR: Proteintech

Proteintech, 13383-1-AP, HSPH1 Polyclonal antibody

CATALOG NUMBER: 13383-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • ddddd

    99 xxxxxx

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSPH1 (13383-1-AP) by Proteintech is a Polyclonal antibody targeting HSPH1 in WB, IHC, ELISA applications with reactivity to human samples 13383-1-AP targets HSPH1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF7 cells, HeLa cells, human brain tissue, Jurkat cells, K-562 cells Positive IHC detected in: human colon cancer tissue, human testis tissue, human liver cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:1200 Background Information HSP105, also known as HSP110 or HSPH1, belongs to the heat shock protein (HSP) family. Human HSP105 is a high-molecular-weight chaperone protein expressed at constitutively low levels as a cytoplasmic α-isoform and as an inducible nuclear β-isoform on exposure to various forms of stress. HSP105 is constitutively overexpressed in several solid tumors, including melanoma, breast, thyroid, and gastroenteric cancers, and exerts antiapoptotic functions. Recently HSP105 has been identified as a novel candidate biomarker of lymphoma aggressiveness. This antibody recognizes both HSP105α and HSP105β isoforms. Western blot analysis using this antibody detected a major band around 100-110 kDa in Jurkat cells. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4224 Product name: Recombinant human HSPH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 508-858 aa of BC037553 Sequence: MSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLGKDLLNMYIETEGKMIMQDKLEKERNDAKNAVEEYVYEFRDKLCGPYEKFICEQDHQNFLRLLTETEDWLYEEGEDQAKQAYVDKLEELMKIGTPVKVRFQEAEERPKMFEELGQRLQHYAKIAADFRNKDEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQAKKSLDQDPVVRAQEIKTKIKELNNTCEPVVTQPKPKIESPKLERTPNGPNIDKKEEDLEDKNNFGAEPPHQNGECYPNEKNSVNMDLD Predict reactive species Full Name: heat shock 105kDa/110kDa protein 1 Calculated Molecular Weight: 858 aa, 97 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC037553 Gene Symbol: HSPH1 Gene ID (NCBI): 10808 RRID: AB_2233157 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92598 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924